SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266835.mlr0803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mlr0803
Domain Number 1 Region: 119-327
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.85e-53
Family D-glucarate dehydratase-like 0.0000177
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.46e-30
Family Enolase N-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr0803
Sequence length 327
Comment (Mesorhizobium loti)
Sequence
MARVISVEAERFPIAGSFTISRGSKTEAEVITCTISQDGHSGRGECVPYKRYGETMDGVH
AAIEAMRERIAGGIDRTALLDAMPAGAARNAVDCALWDLEAKISGKPVANAIWPAPLRPL
ETAYTLSLGEPEAMAAQASANAGRPLLKVKIGGDNDTARIRAVTEAAPQSRIILDANEGW
TDDNIVANLVFAAEHGIALVEQPLPAGRDEILRHIAHPLPICADESVHEAKNLETLVGLY
DAVNIKLDKSGGLTAALVLRDRARELGFGIMVGCMVGTSLAMAPAVLLAQDADFVDLDGP
LLLARDRVPGLVYQGSLVSPPDRALWG
Download sequence
Identical sequences Q98LZ8
WP_010909670.1.45716 266835.mlr0803 gi|13470960|ref|NP_102529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]