SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mlr2370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266835.mlr2370
Domain Number - Region: 58-99
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.0785
Family Cryptochrome/photolyase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr2370
Sequence length 181
Comment (Mesorhizobium loti)
Sequence
MAAMANELGYRTARDLFLACPAIARDMKSLATGQPPLDFCRALLAGRVPEEAVTFCAYLL
PERAAVWWGHECLSNLAELLADRDLELLALVHDRVGEPDNPHHQAVLSNSLDLPPATPAA
WIALAAVWRDPTLDMVSTGFPAAHAVNAGILAGLARASLADRFSVLSAFVEMGIQMAEME
A
Download sequence
Identical sequences A0A1A5ILV7 A0A1E2T3H0 Q98IJ7
266835.mlr2370 WP_010910871.1.100680 WP_010910871.1.15801 WP_010910871.1.18636 WP_010910871.1.29505 WP_010910871.1.29585 WP_010910871.1.37186 WP_010910871.1.45716 WP_010910871.1.54613 WP_010910871.1.60724 WP_010910871.1.62138 WP_010910871.1.7437 WP_010910871.1.86590 gi|13472166|ref|NP_103733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]