SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266835.mlr5450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266835.mlr5450
Domain Number 1 Region: 24-218
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000575
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr5450
Sequence length 518
Comment (Mesorhizobium loti)
Sequence
MLDAVPPFHAKAGAQDDERVIKLAVLAVGGQGGGVLADWITDVAERNGYVAQSTSVAGVA
QRTGATIYYVEMARDTGRLPVFALSPSQGDVDILIAAELMEAGRAIIRGFVTPERTTLIA
SSHRIAAVSEKIEPGDGRASSSKVHATAEAASKRFIAFDMEKIAADNGSMISASLLGALA
GSDALPFTRESYEQAIGAGGRGVKASLAAFGAAFDRARGTAAPVSKPAEPAIVESALGRV
SGPQGLLQGWQALAARVDLMPVAIRDMALRGLRKVVDYQDIAYGREYLDRLDKAVALDSV
DHAYALSIAAAKHLANALCYDDMIRVADLKTRSTRDRRVRKEVGVKDGSILQVTEYFHPR
IEEFCGTLPAGLGSYIENRPKLAAFLDRRINHGRRIRTDSFAGFAALWFIGGLRRWRRSL
LRHKVETAHLDRWYALALGYLPQDYALAVEILNCRRLIKGYSDTHVRAQSKFDRVLSALP
MLKGRDDAADWIRRLREAALKDEKGDMLDGALKTVATL
Download sequence
Identical sequences Q98BS3
WP_010913237.1.45716 266835.mlr5450 gi|13474544|ref|NP_106113.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]