SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266835.mlr8007 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  266835.mlr8007
Domain Number - Region: 6-129
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.0157
Family MalF N-terminal region-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266835.mlr8007
Sequence length 145
Comment (Mesorhizobium loti)
Sequence
MPAIQTNYSAQHARWIEGMVLNMEPSDIVSRLCEDAEGIGFGKVAVQGTADNQVVDSEAT
VKFCGIAVLDSTQPTGKYEQYATAAIMKKGVIVVQASVAVAVGDPVYYVPATGVLTNSAS
GNTLIANAQWDTSTAGAGLAALRLG
Download sequence
Identical sequences Q984H2
WP_010915284.1.45716 gi|13476627|ref|NP_108197.1| 266835.mlr8007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]