SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_0364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_0364
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000118
Family Smr domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_0364
Sequence length 81
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MLSLDLHPIFRSNRDLDTALRTFLVRAAASGEQTVEIVPGKGSAALRQRVLTFLAQPHVR
KLYRSAEVDARNPGRVLVHLR
Download sequence
Identical sequences A6W4W5
gi|152964334|ref|YP_001360118.1| 266940.Krad_0364 WP_012085318.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]