SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_1376 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_1376
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily RNase III domain-like 2.62e-42
Family RNase III catalytic domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 100-211
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.54e-24
Family Double-stranded RNA-binding domain (dsRBD) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_1376
Sequence length 224
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MEIDAGLLELALTHRSYAYEQGGLPTNERLEFLGDSVLGLVVTHELYTRFEDVSEGRLAK
LRAAVVNSRALADIARGLDLGAHVRLGKGELGTGGRDKSSILADTMEAVIGAAFLSVGMD
GAREFVLRLTSPLMDSSERLGAGTDWKTALQELTASEGLGVPSYAITDSGPDHAKNFTAD
AVVGGTVLGHGEGRSKKEAEQKAAAAAVEALREATAAAAVRSSR
Download sequence
Identical sequences A6W7S5
gi|152965344|ref|YP_001361128.1| 266940.Krad_1376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]