SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_3088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_3088
Domain Number 1 Region: 88-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000183
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_3088
Sequence length 160
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MEFLDALLDRSWLLWVAAALVLGILEITAIDLVFAMLAGGALAGALADALGLGFVGQVLV
AAAVAGLLIGTIRPVLLRRLRMPPLGTTNSAALVGRAALVLQPVTVRGGLVKLVGETWSA
RSTGPAFAEGEDVVVTAIDGATAVVGPLPAEPAQLPEEKP
Download sequence
Identical sequences A6WCL3
WP_012087197.1.7041 266940.Krad_3088 gi|152967032|ref|YP_001362816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]