SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_3093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_3093
Domain Number 1 Region: 41-126
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000916
Family DNA-binding N-terminal domain of transcription activators 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_3093
Sequence length 199
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MSSGDAVAGSSHKSTPPARSQGLLFSEDLPDLDEEVGYRGQTACKAAGITYRQLDYWART
GLVEPGVRGASGSGSQRLYGFRDILVLKVVKRLLDTGVSLHQIRTAVTHLRERGVDDLAQ
ITLMSDGASVYECTSADEVIDLVQGGQGVFGIAVGRVWREVEGELASLPSERPAPRDPGQ
TAMVLADELSRRRAARKAV
Download sequence
Identical sequences A6WCL8
WP_012087192.1.7041 gi|152967037|ref|YP_001362821.1| 266940.Krad_3093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]