SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 266940.Krad_4403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  266940.Krad_4403
Domain Number 1 Region: 98-390
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.03e-72
Family D-glucarate dehydratase-like 0.00044
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.4e-33
Family Enolase N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 266940.Krad_4403
Sequence length 406
Comment (Kineococcus radiotolerans SRS30216)
Sequence
MKIVDATVLVTCPGRNFVTLRITTDEGVTGLGDATLNGREQAVVAYLREHVVPLLLGTDP
HRIEDTWQSLYRGAYWRRGPVTMAAIAAVDVALWDIKAKVANLPLYQLLGGASRERVRTY
GHANGRDIPELLDSVRARQAEGYQAIRVQTGVPGLRKVYGVHTGEAIAHNPTRLDQRAVP
VVEDWDTPAYLRHLPTVLEAVRNEFGPELPLLHDAHHRLTPLQAAKLGKDVERYDLFWLE
DCTPAENQEAFRLVRHHTTTPLAVGEVFNTVFDYQTLIAEQLIDYARSAVTHFGGVSALR
KLFDFAAQHQVKSAIHGPEDISPVGMAAAIHLDLAVHNFGIQEYSGHTDATNEVFRHAYT
FTDGHLHPGEAPGIGVDYDEELAAAHPYDPAYLPVNRLADGTVHDW
Download sequence
Identical sequences A6WGC3
NYSGXRC-9262e gi|152968342|ref|YP_001364126.1| WP_012085836.1.7041 266940.Krad_4403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]