SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267377.MMP1271 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267377.MMP1271
Domain Number 1 Region: 11-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.58e-52
Family PFOR PP module 0.044
Further Details:      
 
Domain Number 2 Region: 303-475
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.06e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267377.MMP1271
Sequence length 479
Comment (Methanococcus maripaludis S2)
Sequence
MAEITEKVLKKPNAMPEIFERKGGSAPTATHYCAGCGHGIIHKLMAKSMDELEIQDRCVL
ISPVGCAVFAYYYFDCGNIQVAHGRAPAVGTGVSRAEDNAIVMSYQGDGDLASIGLNETL
QAANRGEKMAVFFVNNTVYGMTGGQMAPTTLIGEKTVTCQTGRDPRFAGYPIHMCELLSS
LKAPVFIERVSVSDIAHIRKAKRAIKKALEIQRDGKGYAFVEILSPCPTNLKQNAQAAEK
FINEEMEKEFPLQNFRDRSAEVETLNRGESDFSKECLDKIFEVDSKGSEDPSKDDSFEEK
LVKIAGFGGQGVLSMGLTLAEAACRAQKYVSWYPSYGPEQRGGTSNCSVIISGQEIGSPV
VYNPEVLIALNKPSLENFAKDVKVGGTIIYDENIGEFEVPNGVTAIKVPASKIATEMGVS
RAANTVMLGVLAEIGYTGLSESVFVGAIEQTFSKKPKLIPINVEILNAGISWAKENLAL
Download sequence
Identical sequences Q6LXS7
gi|45358834|ref|NP_988391.1| 267377.MMP1271 WP_011171215.1.40991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]