SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267608.RS02602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RS02602
Domain Number 1 Region: 290-356
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000228
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0092
Further Details:      
 
Weak hits

Sequence:  267608.RS02602
Domain Number - Region: 55-81
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00984
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267608.RS02602
Sequence length 380
Comment (Ralstonia solanacearum)
Sequence
MLQRLSDDAEFHRLVDTIYESVLDPAQMPIALALLSVYAGAESAHYFVWDKHADAPRNGA
SSGWCHNCPQAGHCHEFCRDPQLLRSDAASCCTDTPVDMGADGTHPIAGMTLMDTPDLCV
TMRLRTRDDTSEVSALERKQRLERVLPHLQRAARMQQRNQELNELAALGMAGLDTLDFGV
MVIERGMRVKYANAWVRAMVTEDDRLSLDGGILRSADHSHDAALQKLIDQASGSIGVQGA
AGSWMYLARDGRPVPFIATPLAPSDAVRPAWKSPLALVLVGNSETRSVMDAGVLASLFGL
TNKECIVAARLAAGETLQEIADREFLSLHTVRVHIRDILRKTGTHRQSELVRLLHLLPSV
DLERAGAATPASRKRPRLHA
Download sequence
Identical sequences Q8XQX2
gi|17549317|ref|NP_522657.1|NC_003296 gi|499313610|ref|WP_011004385.1|NZ_CM002756 gi|499313610|ref|WP_011004385.1|NZ_CM002758 gi|17549317|ref|NP_522657.1| 267608.RS02602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]