SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267608.RSc0803 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSc0803
Domain Number 1 Region: 32-220
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.24e-24
Family Clp protease, ClpP subunit 0.037
Further Details:      
 
Domain Number 2 Region: 391-464
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000314
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267608.RSc0803
Sequence length 470
Comment (Ralstonia solanacearum)
Sequence
MRPSLRIRQWIGWLAAGLAAAWSGLAIAAAAPVMVLPLTGAIGPASAAYVVHGLELARKE
GMQLVVLQMDTPGGLDASMRQIIQAILASPVPVAGYVAPGGARAASAGTYILYASHIAAM
APATNLGAASPVAIGIGGHAPTGPTPTPGDTAKPASAPAAASGNEDTLARKQMHDAAAYI
RGLAHLRGRNAEWAERAVREAVSLSADEAATQRVIDLIATNIPDLLRQVDGRALRTATGL
VTLHTAGAPTETLEPDWRNHFLAVITDPSLALLLLTVGVYALIFEFSTPGMVVPGILGAM
CILVALYGLQMLPINYAGLALLALGLGCMVAEAFLPTFGALGVGGIIAFILGAVMLIDTQ
TPGYGVPIPVIVGLAFVSLTVILALSSLAVRARRRPKVSGGDTLIGMTGEVVDVDTPEAD
ADSDGWAHIRGERWRVRCDAGITRGDRVRVIARHGLTLMVEPVAPAAAAS
Download sequence
Identical sequences A0A0K1ZN17 A0A223GK92 Q8Y187
gi|17545522|ref|NP_518924.1| 267608.RSc0803 WP_011000757.1.19504 WP_011000757.1.25797 WP_011000757.1.32568 WP_011000757.1.37141 WP_011000757.1.58753 WP_011000757.1.65551 WP_011000757.1.67756 WP_011000757.1.67790 WP_011000757.1.73188 WP_011000757.1.76782 WP_011000757.1.80635 WP_011000757.1.81933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]