SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267608.RSc1828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSc1828
Domain Number 1 Region: 6-208
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000209
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267608.RSc1828
Sequence length 503
Comment (Ralstonia solanacearum)
Sequence
MTVEPIKIAILAMGGEGGGVLADWIVDLGEANGYFAQTTSVPGVAQRTGATIYYVELFPG
AADAPARAPVLALMPMPGDVDVVLASELMEAGRAVQRGFVTRERTTLIASSHRVYSIAEK
SAMGDGRVDSDGLARQAREAARHFFSFDMAEAAERAGSVVSAVLFGALSGSGVLPFSREQ
FEATIERGGVGVKPSLKAFDAGYARARPGQPDGTADAPRPMPADAAPAPRDPAVAVLLER
ARRFAPQVSAIAIEGVRRLIDYQDPAYAGLYLDRLDALSAAPGGSQPDLLGETARHLALW
MSYEDTIRVADLKTRGSRFERVRGEVRAKSDQLLQINEFMHPRIEEICETLPAGLGRWLA
RPHWAHRLVARFTRQGRVVKTSSLGGFLLLYTLARWGRWRRTTLRYALENARIEAWLRRV
RAVAAINPALALETAQCQRLVKGYGDTHARGLKHYETLMTVVDRHADTLPPQTLRELRDA
ALADEHGNQLRACLQRHAFSVEG
Download sequence
Identical sequences A0A223GMY6 Q8XYD0
267608.RSc1828 WP_011001766.1.81933 gi|17546547|ref|NP_519949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]