SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 267608.RSc1873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSc1873
Domain Number 1 Region: 90-288
Classification Level Classification E-value
Superfamily Formyltransferase 2.22e-61
Family Formyltransferase 0.00023
Further Details:      
 
Domain Number 2 Region: 6-85
Classification Level Classification E-value
Superfamily ACT-like 7.5e-20
Family Glycine cleavage system transcriptional repressor 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267608.RSc1873
Sequence length 288
Comment (Ralstonia solanacearum)
Sequence
MSHSGFILTLSCPDQPGIVHAVSGLLFEQGCNILDSDQFGDEFTGRFFMRVHFVPQGQPL
DLQALRERFAPIGERFSMQWGMFDAAVKPRVMILVSKIGHCLNDLLFRARAGQLPIEIAA
IVSNHRDFYQLAASYDVPFLHLPLLKGTDAQKAQQEARIREIIEEQRIDLVVLARYMQIL
SDDLCRQLEGRAINIHHSFLPSFKGAKPYYQAHERGVKLIGATAHYVTAELDEGPIIEQE
IERVDHSMDPEQLTAVGRDVECVALARAVKWHAEHRILLNGHKTVVFK
Download sequence
Identical sequences A0A0K1ZJE5 A0A1L3DDG0 A0A223GN42 Q8XY90
267608.RSc1873 WP_011001810.1.13792 WP_011001810.1.19504 WP_011001810.1.28416 WP_011001810.1.37141 WP_011001810.1.39277 WP_011001810.1.49711 WP_011001810.1.51566 WP_011001810.1.57025 WP_011001810.1.57909 WP_011001810.1.58753 WP_011001810.1.64558 WP_011001810.1.65551 WP_011001810.1.67756 WP_011001810.1.72398 WP_011001810.1.73188 WP_011001810.1.76782 WP_011001810.1.80635 WP_011001810.1.81933 gi|17546592|ref|NP_519994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]