SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267608.RSc2751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSc2751
Domain Number 1 Region: 95-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.28e-74
Family D-glucarate dehydratase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.92e-32
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267608.RSc2751
Sequence length 382
Comment (Ralstonia solanacearum)
Sequence
MKITRLTTYRLPPRWMFLKIETDEGVAGWGEPVIEGRARTVEAAVHELADYLVGQDPRRI
NDLWQTLYRGGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDRMRTYSWV
GGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDSARAVDAAVARVAEIRAAFGNTVEF
GLDFHGRVSAPMAKVLIRALEPYRPLFIEEPVLAEQAESYARLAAQTHLPIAAGERMFSR
FEFKRVLEAGGLAILQPDLSHAGGITECLKIAGMAEAYDVALAPHCPLGPIALAACLHID
FVSWNATLQEQSMGIHYNQGAELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIER
SRSAPDWRNPVWRHADGSVAEW
Download sequence
Identical sequences A0A0K1ZHZ3 A0A1L3DB03 A0A223H4F8 M4UG17 Q8XVS8
gi|525971015|ref|YP_007633689.1| 267608.RSc2751 gi|17547470|ref|NP_520872.1| WP_011002658.1.10616 WP_011002658.1.19504 WP_011002658.1.25797 WP_011002658.1.32568 WP_011002658.1.37141 WP_011002658.1.39277 WP_011002658.1.49711 WP_011002658.1.51566 WP_011002658.1.58753 WP_011002658.1.65509 WP_011002658.1.65551 WP_011002658.1.67163 WP_011002658.1.67756 WP_011002658.1.67790 WP_011002658.1.73188 WP_011002658.1.80635 WP_011002658.1.81933 WP_011002658.1.87978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]