SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267608.RSp0829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267608.RSp0829
Domain Number 1 Region: 136-414
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.71e-76
Family D-glucarate dehydratase-like 0.00000000232
Further Details:      
 
Domain Number 2 Region: 14-134
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.42e-22
Family Enolase N-terminal domain-like 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267608.RSp0829
Sequence length 445
Comment (Ralstonia solanacearum)
Sequence
MTLQHIETGARAQTPRVTRMQVIPVAGHDSMLLNLCGAHAPFFTRNLVILADSAGRTGVG
EVPGGEGIRRALAGHGDAARQTTVHEVTSASEAAVLRQPHEINLRMDNVLTAVEAALLDL
LGQHLEVPVAELLGTGQQRDAVPMLAYLFYVGERRKTDLPYLDGAGAGAADGWLRLRHEA
AMAPAQIARLAEAAAERYGFADFKLKGGVMRGADEMEAIAAIKARFPHARVTLDPNGAWS
LDEAIALCRGQGHLLAYAEDPCGPEAGYSGREIMAEFKRATGVPTATNMIATDWRQLGHA
VPLQAVDIPLADPHFWTMQGSARVAQLCNDWGLTWGSHSNNHFDVSLAMFTHVAAAAPGR
ITAIDTHWIWQEGQERLTREPLRIEGGQVRVPQQPGLGIELDMDRVMQAHALYQTLGTGA
RDDAMAMQYLVPGWTYDPKRPSLAH
Download sequence
Identical sequences A0A223GUP7 Q8XRK2
267608.RSp0829 NYSGXRC-9499o gi|17549050|ref|NP_522390.1|NC_003296 gi|17549050|ref|NP_522390.1| WP_011004127.1.81933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]