SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC11801 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267671.LIC11801
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.16e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC11801
Sequence length 104
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
MENFNTEILTEGTTCTIKIQGSISLKNAFALKELIIKKHGEGFTEIILDFSGDAYLDSSG
IGAIFNSQKYVTERNGSLKLKNISRDVMTILKIANLDKHLDIIR
Download sequence
Identical sequences A0A098MW79 A0A0C5WPZ8 A0A0E2BBQ3 A0A0E2CP59 A0A0E2CZL1 A0A0F6H7U8 A0A0F6HZY1 A0A0F6I805 A0A0M5L7Y9 A0A161R9T9 A0A1B9FLL2 A0A1N6P4H3 A0A1V2ZSV4 A0A2H1XF81 M3E3B2 M3I629 M3IKG3 M5ZCY6 M6HCM2 M6KE18 M6RLB2 M6TAK1 M6UL22 M6W0Q4 M6YKM1 Q72RE4 Q8F4C4 T0FIE2 V6GU94
gi|386074181|ref|YP_005988498.1| 189518.LA2117 267671.LIC11801 gi|45657667|ref|YP_001753.1| gi|24214817|ref|NP_712298.1| NP_712298.1.97817 WP_000427211.1.10054 WP_000427211.1.100607 WP_000427211.1.100943 WP_000427211.1.10099 WP_000427211.1.101113 WP_000427211.1.102083 WP_000427211.1.11367 WP_000427211.1.11416 WP_000427211.1.11890 WP_000427211.1.12132 WP_000427211.1.12257 WP_000427211.1.12296 WP_000427211.1.13846 WP_000427211.1.14057 WP_000427211.1.14181 WP_000427211.1.15012 WP_000427211.1.1506 WP_000427211.1.15739 WP_000427211.1.16487 WP_000427211.1.17129 WP_000427211.1.17260 WP_000427211.1.17449 WP_000427211.1.175 WP_000427211.1.1759 WP_000427211.1.17762 WP_000427211.1.18168 WP_000427211.1.18925 WP_000427211.1.18988 WP_000427211.1.19091 WP_000427211.1.19636 WP_000427211.1.19821 WP_000427211.1.19906 WP_000427211.1.20233 WP_000427211.1.2069 WP_000427211.1.20778 WP_000427211.1.21012 WP_000427211.1.2170 WP_000427211.1.22564 WP_000427211.1.22580 WP_000427211.1.23212 WP_000427211.1.23353 WP_000427211.1.23514 WP_000427211.1.2392 WP_000427211.1.24270 WP_000427211.1.24738 WP_000427211.1.250 WP_000427211.1.25259 WP_000427211.1.25470 WP_000427211.1.25773 WP_000427211.1.25923 WP_000427211.1.26235 WP_000427211.1.26477 WP_000427211.1.26822 WP_000427211.1.27816 WP_000427211.1.27867 WP_000427211.1.28 WP_000427211.1.28517 WP_000427211.1.2987 WP_000427211.1.30744 WP_000427211.1.30921 WP_000427211.1.30957 WP_000427211.1.31178 WP_000427211.1.3128 WP_000427211.1.31321 WP_000427211.1.3175 WP_000427211.1.31926 WP_000427211.1.32453 WP_000427211.1.32692 WP_000427211.1.32859 WP_000427211.1.3288 WP_000427211.1.33300 WP_000427211.1.33670 WP_000427211.1.339 WP_000427211.1.34232 WP_000427211.1.34457 WP_000427211.1.3451 WP_000427211.1.34735 WP_000427211.1.35515 WP_000427211.1.35633 WP_000427211.1.35956 WP_000427211.1.36087 WP_000427211.1.36128 WP_000427211.1.36297 WP_000427211.1.36581 WP_000427211.1.36759 WP_000427211.1.37254 WP_000427211.1.3754 WP_000427211.1.37594 WP_000427211.1.382 WP_000427211.1.38403 WP_000427211.1.3874 WP_000427211.1.39007 WP_000427211.1.39100 WP_000427211.1.39787 WP_000427211.1.39967 WP_000427211.1.40783 WP_000427211.1.41353 WP_000427211.1.41637 WP_000427211.1.42222 WP_000427211.1.42779 WP_000427211.1.4308 WP_000427211.1.43311 WP_000427211.1.43353 WP_000427211.1.43570 WP_000427211.1.43638 WP_000427211.1.44274 WP_000427211.1.44326 WP_000427211.1.45100 WP_000427211.1.45262 WP_000427211.1.45679 WP_000427211.1.4572 WP_000427211.1.46007 WP_000427211.1.46812 WP_000427211.1.46987 WP_000427211.1.46993 WP_000427211.1.47686 WP_000427211.1.47834 WP_000427211.1.48092 WP_000427211.1.48108 WP_000427211.1.48207 WP_000427211.1.48838 WP_000427211.1.49027 WP_000427211.1.49352 WP_000427211.1.50403 WP_000427211.1.50455 WP_000427211.1.50786 WP_000427211.1.50856 WP_000427211.1.50904 WP_000427211.1.51217 WP_000427211.1.51443 WP_000427211.1.51531 WP_000427211.1.5165 WP_000427211.1.51668 WP_000427211.1.51687 WP_000427211.1.51773 WP_000427211.1.52005 WP_000427211.1.52351 WP_000427211.1.53255 WP_000427211.1.53346 WP_000427211.1.53569 WP_000427211.1.5368 WP_000427211.1.5446 WP_000427211.1.54587 WP_000427211.1.55693 WP_000427211.1.55703 WP_000427211.1.55840 WP_000427211.1.55852 WP_000427211.1.56120 WP_000427211.1.56629 WP_000427211.1.5678 WP_000427211.1.56812 WP_000427211.1.58511 WP_000427211.1.58842 WP_000427211.1.59857 WP_000427211.1.60409 WP_000427211.1.60804 WP_000427211.1.6135 WP_000427211.1.61403 WP_000427211.1.61658 WP_000427211.1.6171 WP_000427211.1.61777 WP_000427211.1.61847 WP_000427211.1.62172 WP_000427211.1.62196 WP_000427211.1.62202 WP_000427211.1.63084 WP_000427211.1.63541 WP_000427211.1.6356 WP_000427211.1.63646 WP_000427211.1.63688 WP_000427211.1.640 WP_000427211.1.64760 WP_000427211.1.64963 WP_000427211.1.65294 WP_000427211.1.65513 WP_000427211.1.65559 WP_000427211.1.65719 WP_000427211.1.6574 WP_000427211.1.66305 WP_000427211.1.66760 WP_000427211.1.668 WP_000427211.1.67052 WP_000427211.1.67243 WP_000427211.1.67344 WP_000427211.1.67411 WP_000427211.1.67421 WP_000427211.1.6761 WP_000427211.1.68135 WP_000427211.1.68799 WP_000427211.1.68993 WP_000427211.1.69136 WP_000427211.1.69218 WP_000427211.1.70155 WP_000427211.1.70516 WP_000427211.1.70913 WP_000427211.1.70921 WP_000427211.1.71080 WP_000427211.1.71461 WP_000427211.1.72166 WP_000427211.1.72187 WP_000427211.1.7280 WP_000427211.1.72830 WP_000427211.1.73036 WP_000427211.1.73107 WP_000427211.1.73302 WP_000427211.1.73583 WP_000427211.1.74258 WP_000427211.1.74515 WP_000427211.1.74558 WP_000427211.1.74792 WP_000427211.1.75054 WP_000427211.1.75316 WP_000427211.1.75377 WP_000427211.1.76063 WP_000427211.1.76404 WP_000427211.1.76740 WP_000427211.1.76970 WP_000427211.1.76971 WP_000427211.1.7707 WP_000427211.1.77178 WP_000427211.1.77242 WP_000427211.1.77874 WP_000427211.1.78069 WP_000427211.1.7821 WP_000427211.1.78364 WP_000427211.1.78551 WP_000427211.1.78739 WP_000427211.1.79237 WP_000427211.1.79939 WP_000427211.1.80044 WP_000427211.1.81113 WP_000427211.1.81443 WP_000427211.1.8167 WP_000427211.1.81803 WP_000427211.1.82080 WP_000427211.1.82393 WP_000427211.1.82978 WP_000427211.1.83052 WP_000427211.1.83201 WP_000427211.1.84222 WP_000427211.1.84376 WP_000427211.1.84406 WP_000427211.1.84450 WP_000427211.1.85034 WP_000427211.1.85491 WP_000427211.1.86863 WP_000427211.1.86894 WP_000427211.1.87123 WP_000427211.1.8721 WP_000427211.1.8748 WP_000427211.1.87797 WP_000427211.1.87860 WP_000427211.1.87965 WP_000427211.1.88006 WP_000427211.1.88138 WP_000427211.1.88844 WP_000427211.1.8916 WP_000427211.1.89725 WP_000427211.1.90188 WP_000427211.1.90537 WP_000427211.1.90631 WP_000427211.1.90803 WP_000427211.1.91009 WP_000427211.1.91013 WP_000427211.1.91017 WP_000427211.1.91046 WP_000427211.1.91324 WP_000427211.1.92349 WP_000427211.1.92480 WP_000427211.1.9249 WP_000427211.1.93413 WP_000427211.1.95586 WP_000427211.1.95618 WP_000427211.1.95810 WP_000427211.1.95836 WP_000427211.1.96306 WP_000427211.1.96462 WP_000427211.1.9683 WP_000427211.1.96841 WP_000427211.1.97198 WP_000427211.1.97216 WP_000427211.1.97385 WP_000427211.1.97472 WP_000427211.1.97703 WP_000427211.1.98154 WP_000427211.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]