SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC11843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  267671.LIC11843
Domain Number - Region: 13-54
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000327
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC11843
Sequence length 59
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
MVPVVKDILVERKGGRILFQGVEWDAISKKSRIPKGNKARILSRDNLTFFVEPLEFPEK
Download sequence
Identical sequences M6RWL3 Q72RA5
189518.LA2073 267671.LIC11843 gi|45657706|ref|YP_001792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]