SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC12398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267671.LIC12398
Domain Number 1 Region: 14-117
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC12398
Sequence length 134
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
MTDLSSRCFFDLMLIRSEIRENHIVLTVLEDILMDNSRDFHSEFEESMKTGNPEIISFFL
GKVKFIDSSGIGIIIKVRNQVREKNGIVNIFGLNKSLNSVFRLSGLDKIVNLYTSEEFLS
KYPIFQEFVDQNSK
Download sequence
Identical sequences A0A098MS98 Q72PR9
gi|45658244|ref|YP_002330.1| 189518.LA1327 267671.LIC12398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]