SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC12787 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267671.LIC12787
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.49e-26
Family Anti-sigma factor antagonist SpoIIaa 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC12787
Sequence length 110
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
MLDHKVRDGVLIVYLKGRLDVSIANEVEENLNDLIDNQGHKKVILNMQEVDYMSSSGFRA
CISTLRKLNSKEGALKISNIKPAVKRIFDVIELTSLFDICETEDEALKSF
Download sequence
Identical sequences A0A098MQ19 A0A0C5XG78 A0A0E2CP53 A0A0E2D7C3 A0A0F6HA82 A0A0F6HZG5 A0A0F6IFZ1 A0A0M3TL01 A0A163P4K5 A0A1B9FEI8 A0A1N6X2E3 A0A1V2ZNB6 A0A2H1XCU5 M3E788 M3G7Q3 M3GVZ2 M5ZJL7 M6HNW7 M6KF00 M6RLJ8 M6W227 N1USF7 Q72NP5 Q8F7V3 T0GUF4
gi|45658618|ref|YP_002704.1| gi|386073160|ref|YP_005987477.1| gi|24213539|ref|NP_711020.1| 189518.LA0839 267671.LIC12787 NP_711020.1.97817 WP_000884017.1.10054 WP_000884017.1.100607 WP_000884017.1.100943 WP_000884017.1.10099 WP_000884017.1.101113 WP_000884017.1.102083 WP_000884017.1.11367 WP_000884017.1.11416 WP_000884017.1.11890 WP_000884017.1.12132 WP_000884017.1.12257 WP_000884017.1.12296 WP_000884017.1.13846 WP_000884017.1.14057 WP_000884017.1.14181 WP_000884017.1.14552 WP_000884017.1.15012 WP_000884017.1.1506 WP_000884017.1.15739 WP_000884017.1.16487 WP_000884017.1.17129 WP_000884017.1.17260 WP_000884017.1.175 WP_000884017.1.1759 WP_000884017.1.17762 WP_000884017.1.18168 WP_000884017.1.18925 WP_000884017.1.18988 WP_000884017.1.19091 WP_000884017.1.19636 WP_000884017.1.19821 WP_000884017.1.19906 WP_000884017.1.20233 WP_000884017.1.2069 WP_000884017.1.20778 WP_000884017.1.2170 WP_000884017.1.22564 WP_000884017.1.22580 WP_000884017.1.23212 WP_000884017.1.23514 WP_000884017.1.2392 WP_000884017.1.24270 WP_000884017.1.24738 WP_000884017.1.250 WP_000884017.1.25259 WP_000884017.1.25470 WP_000884017.1.25773 WP_000884017.1.26235 WP_000884017.1.26477 WP_000884017.1.26822 WP_000884017.1.27867 WP_000884017.1.28 WP_000884017.1.28517 WP_000884017.1.2987 WP_000884017.1.30744 WP_000884017.1.30921 WP_000884017.1.30957 WP_000884017.1.31178 WP_000884017.1.3128 WP_000884017.1.31321 WP_000884017.1.3175 WP_000884017.1.31926 WP_000884017.1.32453 WP_000884017.1.32692 WP_000884017.1.32859 WP_000884017.1.3288 WP_000884017.1.33670 WP_000884017.1.339 WP_000884017.1.34232 WP_000884017.1.34457 WP_000884017.1.34735 WP_000884017.1.35515 WP_000884017.1.35633 WP_000884017.1.35956 WP_000884017.1.36087 WP_000884017.1.36128 WP_000884017.1.36297 WP_000884017.1.36581 WP_000884017.1.36759 WP_000884017.1.37254 WP_000884017.1.3754 WP_000884017.1.37594 WP_000884017.1.382 WP_000884017.1.38403 WP_000884017.1.3874 WP_000884017.1.39007 WP_000884017.1.39100 WP_000884017.1.39787 WP_000884017.1.39967 WP_000884017.1.40783 WP_000884017.1.41353 WP_000884017.1.41637 WP_000884017.1.42222 WP_000884017.1.42779 WP_000884017.1.4308 WP_000884017.1.43311 WP_000884017.1.43353 WP_000884017.1.43570 WP_000884017.1.44274 WP_000884017.1.44326 WP_000884017.1.45100 WP_000884017.1.45262 WP_000884017.1.45679 WP_000884017.1.4572 WP_000884017.1.46007 WP_000884017.1.46812 WP_000884017.1.46987 WP_000884017.1.46993 WP_000884017.1.47686 WP_000884017.1.47834 WP_000884017.1.48092 WP_000884017.1.48108 WP_000884017.1.48207 WP_000884017.1.48838 WP_000884017.1.49027 WP_000884017.1.49352 WP_000884017.1.50403 WP_000884017.1.50455 WP_000884017.1.50786 WP_000884017.1.50856 WP_000884017.1.50904 WP_000884017.1.51217 WP_000884017.1.51443 WP_000884017.1.51531 WP_000884017.1.5165 WP_000884017.1.51687 WP_000884017.1.51773 WP_000884017.1.52005 WP_000884017.1.52351 WP_000884017.1.53255 WP_000884017.1.53346 WP_000884017.1.53569 WP_000884017.1.5368 WP_000884017.1.5446 WP_000884017.1.54587 WP_000884017.1.55693 WP_000884017.1.55840 WP_000884017.1.55852 WP_000884017.1.56120 WP_000884017.1.56629 WP_000884017.1.5678 WP_000884017.1.56812 WP_000884017.1.58511 WP_000884017.1.58842 WP_000884017.1.59857 WP_000884017.1.60409 WP_000884017.1.60804 WP_000884017.1.6135 WP_000884017.1.61403 WP_000884017.1.61658 WP_000884017.1.6171 WP_000884017.1.61777 WP_000884017.1.62172 WP_000884017.1.62196 WP_000884017.1.62202 WP_000884017.1.63084 WP_000884017.1.63541 WP_000884017.1.63646 WP_000884017.1.63688 WP_000884017.1.640 WP_000884017.1.64760 WP_000884017.1.64963 WP_000884017.1.65294 WP_000884017.1.65513 WP_000884017.1.65559 WP_000884017.1.65719 WP_000884017.1.6574 WP_000884017.1.66305 WP_000884017.1.668 WP_000884017.1.67052 WP_000884017.1.67243 WP_000884017.1.67344 WP_000884017.1.67411 WP_000884017.1.67421 WP_000884017.1.6761 WP_000884017.1.68135 WP_000884017.1.68426 WP_000884017.1.68799 WP_000884017.1.68993 WP_000884017.1.69136 WP_000884017.1.69218 WP_000884017.1.70155 WP_000884017.1.70516 WP_000884017.1.70913 WP_000884017.1.70921 WP_000884017.1.71080 WP_000884017.1.71461 WP_000884017.1.72166 WP_000884017.1.72187 WP_000884017.1.7280 WP_000884017.1.72830 WP_000884017.1.73036 WP_000884017.1.73107 WP_000884017.1.73302 WP_000884017.1.73583 WP_000884017.1.74258 WP_000884017.1.74515 WP_000884017.1.74558 WP_000884017.1.74792 WP_000884017.1.75054 WP_000884017.1.75316 WP_000884017.1.75377 WP_000884017.1.76063 WP_000884017.1.76404 WP_000884017.1.76740 WP_000884017.1.76970 WP_000884017.1.76971 WP_000884017.1.7707 WP_000884017.1.77178 WP_000884017.1.77242 WP_000884017.1.77874 WP_000884017.1.78069 WP_000884017.1.7821 WP_000884017.1.78364 WP_000884017.1.78551 WP_000884017.1.78739 WP_000884017.1.79237 WP_000884017.1.79939 WP_000884017.1.81113 WP_000884017.1.81443 WP_000884017.1.8167 WP_000884017.1.81803 WP_000884017.1.82080 WP_000884017.1.82375 WP_000884017.1.82393 WP_000884017.1.82978 WP_000884017.1.83052 WP_000884017.1.83201 WP_000884017.1.84222 WP_000884017.1.84376 WP_000884017.1.84406 WP_000884017.1.84450 WP_000884017.1.85034 WP_000884017.1.86863 WP_000884017.1.86894 WP_000884017.1.87123 WP_000884017.1.8721 WP_000884017.1.8748 WP_000884017.1.87797 WP_000884017.1.87860 WP_000884017.1.87965 WP_000884017.1.88006 WP_000884017.1.88138 WP_000884017.1.88844 WP_000884017.1.8916 WP_000884017.1.89725 WP_000884017.1.90188 WP_000884017.1.90537 WP_000884017.1.90631 WP_000884017.1.90803 WP_000884017.1.91009 WP_000884017.1.91013 WP_000884017.1.91017 WP_000884017.1.91046 WP_000884017.1.91324 WP_000884017.1.92349 WP_000884017.1.92480 WP_000884017.1.9249 WP_000884017.1.93413 WP_000884017.1.95586 WP_000884017.1.95810 WP_000884017.1.95836 WP_000884017.1.96306 WP_000884017.1.96462 WP_000884017.1.9683 WP_000884017.1.96841 WP_000884017.1.97198 WP_000884017.1.97385 WP_000884017.1.97472 WP_000884017.1.97703 WP_000884017.1.98154 WP_000884017.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]