SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC20108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267671.LIC20108
Domain Number 1 Region: 22-127
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC20108
Sequence length 132
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
METTNNSKDELSVEIISNSHVNHLLKPHMTIVKTSGEVNIFSSKKLKDLFNSKIDEGARV
LLLDLSATTHIDSSGLAVLISTQAKLMKQLKGALIVYAIPSPINKIFELTRLDKLITMSI
DLDEALDKAMTF
Download sequence
Identical sequences A0A1N6NKZ7 A0A1X8WP14 Q75FS3 Q8EXS2
gi|386076147|ref|YP_005990336.1| gi|45655691|ref|YP_003500.1| NP_714680.1.97817 WP_000450441.1.10054 WP_000450441.1.100943 WP_000450441.1.101113 WP_000450441.1.101360 WP_000450441.1.11367 WP_000450441.1.12257 WP_000450441.1.12296 WP_000450441.1.13846 WP_000450441.1.14057 WP_000450441.1.14552 WP_000450441.1.15739 WP_000450441.1.17129 WP_000450441.1.17260 WP_000450441.1.1759 WP_000450441.1.17762 WP_000450441.1.18168 WP_000450441.1.19091 WP_000450441.1.19636 WP_000450441.1.20233 WP_000450441.1.2069 WP_000450441.1.22580 WP_000450441.1.23212 WP_000450441.1.23353 WP_000450441.1.2392 WP_000450441.1.250 WP_000450441.1.25470 WP_000450441.1.28 WP_000450441.1.28517 WP_000450441.1.2987 WP_000450441.1.30921 WP_000450441.1.30957 WP_000450441.1.31178 WP_000450441.1.32453 WP_000450441.1.32692 WP_000450441.1.32859 WP_000450441.1.33670 WP_000450441.1.339 WP_000450441.1.34457 WP_000450441.1.35633 WP_000450441.1.36128 WP_000450441.1.3754 WP_000450441.1.38403 WP_000450441.1.39007 WP_000450441.1.39787 WP_000450441.1.39967 WP_000450441.1.40783 WP_000450441.1.41353 WP_000450441.1.42222 WP_000450441.1.43311 WP_000450441.1.43353 WP_000450441.1.4572 WP_000450441.1.46812 WP_000450441.1.48092 WP_000450441.1.48108 WP_000450441.1.48207 WP_000450441.1.49352 WP_000450441.1.50786 WP_000450441.1.50904 WP_000450441.1.51217 WP_000450441.1.52005 WP_000450441.1.52351 WP_000450441.1.53255 WP_000450441.1.55693 WP_000450441.1.56120 WP_000450441.1.61658 WP_000450441.1.63084 WP_000450441.1.63541 WP_000450441.1.63646 WP_000450441.1.64760 WP_000450441.1.65294 WP_000450441.1.65513 WP_000450441.1.668 WP_000450441.1.67344 WP_000450441.1.6761 WP_000450441.1.68426 WP_000450441.1.69218 WP_000450441.1.70516 WP_000450441.1.72166 WP_000450441.1.72187 WP_000450441.1.7280 WP_000450441.1.72830 WP_000450441.1.73302 WP_000450441.1.74515 WP_000450441.1.74558 WP_000450441.1.75054 WP_000450441.1.75377 WP_000450441.1.76404 WP_000450441.1.76971 WP_000450441.1.77242 WP_000450441.1.78069 WP_000450441.1.7821 WP_000450441.1.78364 WP_000450441.1.78551 WP_000450441.1.79237 WP_000450441.1.81803 WP_000450441.1.82080 WP_000450441.1.82375 WP_000450441.1.82393 WP_000450441.1.83201 WP_000450441.1.84222 WP_000450441.1.84406 WP_000450441.1.84450 WP_000450441.1.86863 WP_000450441.1.87123 WP_000450441.1.8721 WP_000450441.1.8748 WP_000450441.1.87797 WP_000450441.1.88006 WP_000450441.1.88844 WP_000450441.1.89725 WP_000450441.1.90537 WP_000450441.1.91009 WP_000450441.1.91013 WP_000450441.1.91017 WP_000450441.1.91046 WP_000450441.1.91324 WP_000450441.1.9249 WP_000450441.1.95586 WP_000450441.1.95836 WP_000450441.1.9683 WP_000450441.1.96841 WP_000450441.1.97198 WP_000450441.1.97216 WP_000450441.1.97703 WP_000450441.1.98154 WP_000450441.1.9886 189518.LB136 267671.LIC20108 gi|24217197|ref|NP_714680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]