SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267671.LIC20252 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267671.LIC20252
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000471
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 267671.LIC20252
Sequence length 109
Comment (Leptospira interrogans serovar Copenhageni)
Sequence
MNPIQRYERFEIKRNRQSTEVTPLISSFDEVTLDELKSVLALLFYQSNLHVKINLHEIKV
LPLPAAMKLISFAFDLRLKNRTLVISGASVSLKKLIQFYRMDKVILVLS
Download sequence
Identical sequences A0A0E2CY18 A0A0F6H9A6 A0A0M3TMX8 A0A1N6NT72 A0A1X8WNA0 A0A2H1XL11 M3E172 M3HP01 M3I759 M6G221 M6KFN6 M6ZXL2 Q75FE2 Q8EX83
gi|24217392|ref|NP_714875.1| gi|386076301|ref|YP_005990490.1| gi|45655827|ref|YP_003636.1| 189518.LB330 267671.LIC20252 NP_714875.1.97817 WP_001068299.1.10054 WP_001068299.1.100607 WP_001068299.1.100943 WP_001068299.1.10099 WP_001068299.1.101113 WP_001068299.1.101360 WP_001068299.1.11367 WP_001068299.1.11890 WP_001068299.1.12257 WP_001068299.1.12296 WP_001068299.1.13846 WP_001068299.1.14057 WP_001068299.1.14552 WP_001068299.1.15012 WP_001068299.1.15739 WP_001068299.1.17129 WP_001068299.1.17260 WP_001068299.1.1759 WP_001068299.1.17762 WP_001068299.1.18168 WP_001068299.1.18925 WP_001068299.1.19091 WP_001068299.1.19636 WP_001068299.1.19821 WP_001068299.1.19906 WP_001068299.1.20233 WP_001068299.1.2069 WP_001068299.1.20778 WP_001068299.1.2170 WP_001068299.1.22564 WP_001068299.1.22580 WP_001068299.1.23212 WP_001068299.1.23353 WP_001068299.1.2392 WP_001068299.1.24270 WP_001068299.1.250 WP_001068299.1.25470 WP_001068299.1.26235 WP_001068299.1.26822 WP_001068299.1.28 WP_001068299.1.28517 WP_001068299.1.2987 WP_001068299.1.30744 WP_001068299.1.30921 WP_001068299.1.30957 WP_001068299.1.31178 WP_001068299.1.3128 WP_001068299.1.31321 WP_001068299.1.3175 WP_001068299.1.31926 WP_001068299.1.32453 WP_001068299.1.32692 WP_001068299.1.32859 WP_001068299.1.3288 WP_001068299.1.33670 WP_001068299.1.339 WP_001068299.1.34232 WP_001068299.1.34457 WP_001068299.1.35515 WP_001068299.1.35633 WP_001068299.1.36128 WP_001068299.1.36297 WP_001068299.1.3754 WP_001068299.1.37594 WP_001068299.1.38403 WP_001068299.1.39007 WP_001068299.1.39100 WP_001068299.1.39787 WP_001068299.1.39967 WP_001068299.1.40783 WP_001068299.1.41353 WP_001068299.1.41637 WP_001068299.1.42222 WP_001068299.1.42779 WP_001068299.1.43311 WP_001068299.1.43353 WP_001068299.1.4572 WP_001068299.1.46007 WP_001068299.1.46812 WP_001068299.1.46987 WP_001068299.1.46993 WP_001068299.1.47834 WP_001068299.1.48092 WP_001068299.1.48108 WP_001068299.1.48207 WP_001068299.1.48838 WP_001068299.1.49352 WP_001068299.1.50403 WP_001068299.1.50455 WP_001068299.1.50786 WP_001068299.1.50904 WP_001068299.1.51217 WP_001068299.1.5165 WP_001068299.1.51773 WP_001068299.1.52005 WP_001068299.1.52351 WP_001068299.1.53255 WP_001068299.1.53346 WP_001068299.1.55693 WP_001068299.1.55703 WP_001068299.1.56120 WP_001068299.1.59857 WP_001068299.1.60804 WP_001068299.1.6135 WP_001068299.1.61658 WP_001068299.1.63084 WP_001068299.1.63541 WP_001068299.1.63646 WP_001068299.1.64760 WP_001068299.1.65294 WP_001068299.1.65513 WP_001068299.1.6574 WP_001068299.1.668 WP_001068299.1.67052 WP_001068299.1.67344 WP_001068299.1.67421 WP_001068299.1.6761 WP_001068299.1.68135 WP_001068299.1.68426 WP_001068299.1.69136 WP_001068299.1.69218 WP_001068299.1.70155 WP_001068299.1.70516 WP_001068299.1.70921 WP_001068299.1.72166 WP_001068299.1.72187 WP_001068299.1.7280 WP_001068299.1.72830 WP_001068299.1.73302 WP_001068299.1.74515 WP_001068299.1.74558 WP_001068299.1.74792 WP_001068299.1.75054 WP_001068299.1.75377 WP_001068299.1.76404 WP_001068299.1.76740 WP_001068299.1.76970 WP_001068299.1.76971 WP_001068299.1.7707 WP_001068299.1.77242 WP_001068299.1.78069 WP_001068299.1.7821 WP_001068299.1.78364 WP_001068299.1.78551 WP_001068299.1.79237 WP_001068299.1.81113 WP_001068299.1.81803 WP_001068299.1.82080 WP_001068299.1.82375 WP_001068299.1.82393 WP_001068299.1.82978 WP_001068299.1.83052 WP_001068299.1.83201 WP_001068299.1.84222 WP_001068299.1.84406 WP_001068299.1.84450 WP_001068299.1.86863 WP_001068299.1.86894 WP_001068299.1.87123 WP_001068299.1.8721 WP_001068299.1.8748 WP_001068299.1.87797 WP_001068299.1.87860 WP_001068299.1.88006 WP_001068299.1.88844 WP_001068299.1.8916 WP_001068299.1.89725 WP_001068299.1.90537 WP_001068299.1.90631 WP_001068299.1.90803 WP_001068299.1.91009 WP_001068299.1.91013 WP_001068299.1.91017 WP_001068299.1.91046 WP_001068299.1.91324 WP_001068299.1.92480 WP_001068299.1.9249 WP_001068299.1.93413 WP_001068299.1.95586 WP_001068299.1.95836 WP_001068299.1.9683 WP_001068299.1.96841 WP_001068299.1.97198 WP_001068299.1.97216 WP_001068299.1.97385 WP_001068299.1.97703 WP_001068299.1.98154 WP_001068299.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]