SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267747.PPA1529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA1529
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000128
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA1529
Sequence length 155
Comment (Propionibacterium acnes KPA171202)
Sequence
MLESFGEHRWLLWAVASAVLACTEMLSGEFTLLMLAAGAGAGAITAAIVPGMWLLQVIVA
AVVAALLLTVLRPTLLRRVREAPGYRSALDKLVGSDGVATSDITDGHGQVKVDGEEWSAR
ALEPGSTIAAGEKIEVYEIDGATLVVYPVFRSLSS
Download sequence
Identical sequences A0A1J4XFR5 A0A1N5A7Q3 A0A2B7IXV0 Q6A7I9 W4TS02
gi|387503908|ref|YP_005945137.1| gi|365965469|ref|YP_004947034.1| GO.2772 gi|365974404|ref|YP_004955963.1| gi|50843007|ref|YP_056234.1| WP_002516971.1.101196 WP_002516971.1.102089 WP_002516971.1.102131 WP_002516971.1.15006 WP_002516971.1.1505 WP_002516971.1.17579 WP_002516971.1.18363 WP_002516971.1.22959 WP_002516971.1.23000 WP_002516971.1.26091 WP_002516971.1.26893 WP_002516971.1.26956 WP_002516971.1.27635 WP_002516971.1.28533 WP_002516971.1.2928 WP_002516971.1.29382 WP_002516971.1.29850 WP_002516971.1.30003 WP_002516971.1.31063 WP_002516971.1.31624 WP_002516971.1.3171 WP_002516971.1.31800 WP_002516971.1.32488 WP_002516971.1.3428 WP_002516971.1.34331 WP_002516971.1.36413 WP_002516971.1.37742 WP_002516971.1.38538 WP_002516971.1.41101 WP_002516971.1.41264 WP_002516971.1.42227 WP_002516971.1.43449 WP_002516971.1.43585 WP_002516971.1.43983 WP_002516971.1.44257 WP_002516971.1.45324 WP_002516971.1.48202 WP_002516971.1.48475 WP_002516971.1.49294 WP_002516971.1.49524 WP_002516971.1.50101 WP_002516971.1.50375 WP_002516971.1.50378 WP_002516971.1.50533 WP_002516971.1.51523 WP_002516971.1.53219 WP_002516971.1.54292 WP_002516971.1.5458 WP_002516971.1.56441 WP_002516971.1.56454 WP_002516971.1.56826 WP_002516971.1.57145 WP_002516971.1.58125 WP_002516971.1.59962 WP_002516971.1.59982 WP_002516971.1.60466 WP_002516971.1.60649 WP_002516971.1.60667 WP_002516971.1.66916 WP_002516971.1.67054 WP_002516971.1.67213 WP_002516971.1.67247 WP_002516971.1.70496 WP_002516971.1.7197 WP_002516971.1.73086 WP_002516971.1.74417 WP_002516971.1.74746 WP_002516971.1.7599 WP_002516971.1.767 WP_002516971.1.76841 WP_002516971.1.7771 WP_002516971.1.80166 WP_002516971.1.81031 WP_002516971.1.81478 WP_002516971.1.83430 WP_002516971.1.86359 WP_002516971.1.87452 WP_002516971.1.89010 WP_002516971.1.90730 WP_002516971.1.90935 WP_002516971.1.91146 WP_002516971.1.91610 WP_002516971.1.92292 WP_002516971.1.94227 WP_002516971.1.97417 WP_002516971.1.97839 WP_002516971.1.98061 WP_002516971.1.98214 267747.PPA1529 gi|407935951|ref|YP_006851593.1| gi|386024500|ref|YP_005942805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]