SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 267747.PPA1904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  267747.PPA1904
Domain Number 1 Region: 242-510
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.04e-64
Family PFOR Pyr module 0.098
Further Details:      
 
Domain Number 2 Region: 24-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.7e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 528-620
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000000188
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 267747.PPA1904
Sequence length 640
Comment (Propionibacterium acnes KPA171202)
Sequence
MPSTDTAHHTTDEREVQPLDRVVIRFAGDSGDGMQLTGDRFTAESAIHGNDISTLPNFPA
EIRAPQGTIPGVSSFQVHFANYDIATPGDQPDVLVVMNPAALAANLGDIRRGGLIILDSA
EFTAKNLKKAGYTEDPRNDGTLESYQVVELNLTGLAVAAVEPFNLGRKNSERAKNMFALG
LLTWLYGRPLGPSEKFLASKFASKPDIRDANFAALKAGHAYGETCELFRVRYEVAPAPMP
EGTYRQVTGNLATAYGLITGANRAGLQLFLGSYPITPASDILHELSKRKAHNVVTFQAED
EIAGVSSAIGASFSGSLGVTTTSGPGMSLKSEAIGLAVMTELPLVVVDVQRAGPSTGMPT
KPEQADLLQAMFGRNGESPVPVLAAKSPSDCFDTALEACRIAVTYRTPVIMLSDGYLGNG
AEPWKVPDLAEIPRIDPHFATEPNTTAADGSPRFMPYRRDPQTLARPWALPGTKGLEHRV
GGLEKSAHTGAISYDPANHEEMVATRAAKVKGIAKTIPPTAVDDPSGDADVLVLGWGSAY
GPITAAVRRVRARGLSIAQAHVRHLNPLPEDLGDVLRRYRQIVVPEMNTGQFAMLLRSKY
LIDVKTISRVRGLPISPVDLCDELCRHCGDSKGSDDTREA
Download sequence
Identical sequences A0A1N5BMA6 Q6A6I8
gi|387504265|ref|YP_005945494.1| gi|365974722|ref|YP_004956281.1| gi|365963543|ref|YP_004945109.1| gi|50843356|ref|YP_056583.1| 267747.PPA1904 gi|365965787|ref|YP_004947352.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]