SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269482.Bcep1808_0398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269482.Bcep1808_0398
Domain Number 1 Region: 4-76
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000161
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269482.Bcep1808_0398
Sequence length 82
Comment (Burkholderia vietnamiensis G4)
Sequence
MTVASAKAALADGLARIDAGASAVDCATLTQFDSSALAVLLAWQRAAQARGTTLDIVNLP
PKLASLACAYGVDALLDGTGRH
Download sequence
Identical sequences A4JAV7
gi|134294510|ref|YP_001118245.1| 269482.Bcep1808_0398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]