SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269482.Bcep1808_7668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  269482.Bcep1808_7668
Domain Number - Region: 61-93
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00656
Family Enolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269482.Bcep1808_7668
Sequence length 119
Comment (Burkholderia vietnamiensis G4)
Sequence
MNFDLKKPCKDCPFRSDITFHLNTERVEEICDAITRKQQTFACHKTTQHDDETGDHIPHD
KEQHCAGALILLERMNKPNQMMRIAERLRYYDRQALHMDAPVFETPEAMIAHFRALNDE
Download sequence
Identical sequences A4JW85
gi|134287422|ref|YP_001109589.1| gi|134287422|ref|YP_001109589.1|NC_009226 269482.Bcep1808_7668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]