SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269483.Bcep18194_A4275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269483.Bcep18194_A4275
Domain Number 1 Region: 144-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.13e-84
Family D-glucarate dehydratase-like 0.000000000746
Further Details:      
 
Domain Number 2 Region: 12-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-33
Family Enolase N-terminal domain-like 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269483.Bcep18194_A4275
Sequence length 450
Comment (Burkholderia 383)
Sequence
MNAVTASPSHDTPRIVDLQAIPVAGHDSMLLNLSGAHGPFFTRNLVILKDSAGRTGVGEV
PGGESIRRTLDDARALVVGQPVGNYHAVLNDVRRTFADRDASGRGLQTFDLRTTIHAVTA
LEAALLDLLGQHLGVPVAALLGEGQQRERVEMLGYLFYIGDRTRTALAYRDGSGATDDWT
RVRDEAALTPEAVVRLAEAAHARYGFNDFKLKGGVFEGASEIEAVTALAERFPDARVTLD
PNGAWSLDEAVRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDW
RQMGHAVQLQAVDIPLADPHFWTMQGSVRVAQMCRDWGLTWGSHSNNHFDVSLAMFTHVA
AAAPGQVTAIDTHWIWQDGERLTREPLKIENGLVEVPKRPGLGIDIDMDAVAVAHELYKQ
HGLGARDDAAAMQYLIPGWTFNNKRPCLVR
Download sequence
Identical sequences Q39I44
WP_011351443.1.41686 gi|78065747|ref|YP_368516.1| 269483.Bcep18194_A4275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]