SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269483.Bcep18194_B0552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269483.Bcep18194_B0552
Domain Number 1 Region: 44-166
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.83e-26
Family Dual specificity phosphatase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269483.Bcep18194_B0552
Sequence length 194
Comment (Burkholderia 383)
Sequence
MKIAVIAALAVTLAGLVQPAHADPASEVSARPIKWAQSVTDAHVNNLHRITPTLYRSAQL
SRSDVPELQKLGIRKVISFRSFHADDTILAGTQIRMQRIRINTWDIRDEDMVAALKALRT
ADQDGPVLIHCQHGADRTGLVSALYRMVYQGWTREQALDELQHGGYGFHPIWQNITNYLK
NVDVERLKREVNSG
Download sequence
Identical sequences Q39A45
269483.Bcep18194_B0552 WP_011354161.1.41686 gi|78061402|ref|YP_371310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]