SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269483.Bcep18194_B0712 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269483.Bcep18194_B0712
Domain Number 1 Region: 57-162,197-255
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.14e-25
Family Clp protease, ClpP subunit 0.089
Further Details:      
 
Domain Number 2 Region: 430-506
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000222
Family NfeD domain-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269483.Bcep18194_B0712
Sequence length 525
Comment (Burkholderia 383)
Sequence
MHFHRHGPPPAPATPGGHPRHPLSARVARAALFAALLVVCAAVAAPSPAEAPAAARPVVV
IPINGAIGPASADFIVRSLDRAARQHAPLAILQLDTPGGLDTSMRQIIKAILGSPVPVAA
FVAPGGARAASAGTYIVYASHFAAMAPGTNLGAASPVQFGIGGAAPPGGNPAAPHAPAGT
SGASGASDAAATQAALPTDTQSTEIRKAMQDASAYIRGLAQLRGRNAEWGERAVREAVSL
SANEARTQHVVDLIAQDPADLARQLDGHTVTTTAGTVRLATAHAPLVVLEPDWRSRFLAI
IADPNVALILLTIGIYGLFFEFANPGFVLPGVVGTICLLVGLFAMQLLPISYAGLGLVLL
GLGCLVAEAFLPTFGVLGFGGIVSFTIGALMLIDTDVPGYGIPWPVIASLALGGGLLVAG
VSSVALRARRRPVVTGAEAMVGSIGEVLDDGLLADQPHGAAGTAPSAAGWARVRGERWRV
ASSAPLAAGCRVRVTGRHGLLLTVAPLYDVPGQEHHQEQHQGEPS
Download sequence
Identical sequences Q399N5
gi|78061562|ref|YP_371470.1| WP_011354320.1.41686 269483.Bcep18194_B0712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]