SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269483.Bcep18194_B2326 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269483.Bcep18194_B2326
Domain Number 1 Region: 269-317
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000103
Family AraC type transcriptional activator 0.031
Further Details:      
 
Domain Number 2 Region: 217-266
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000264
Family AraC type transcriptional activator 0.06
Further Details:      
 
Weak hits

Sequence:  269483.Bcep18194_B2326
Domain Number - Region: 79-196
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00222
Family Regulatory protein AraC 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269483.Bcep18194_B2326
Sequence length 321
Comment (Burkholderia 383)
Sequence
MPMSPTSFEPLALRAHRLFESRDLDETRERISRVMQPHALLPSGRTRGASHMDFVRLGGL
GIGTIAFGDAMRVQVDAVDGYYLLMFCLSGQAEVRAMGRQLGVDGQTGVLCAPGERFDAV
LSADCEQFVLRIDAATVGSLTGDPRATLDPVLHVSDAALAAWRQQLMLVARSPELLERAN
ANPRVASQLEHLLIDLLIEGHPPSVLRASHRDPAPGFVRRAQEFVNAHYAQPLQLADIVQ
AANVPERTLRDAFLQFRGMSPMQYLRATRLDHARELLRGSASDRRIADVALDCGFTHLGR
FAIAYREKFGESPSETLDGKR
Download sequence
Identical sequences Q393C9
269483.Bcep18194_B2326 gi|78063173|ref|YP_373081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]