SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269796.Rru_A2185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269796.Rru_A2185
Domain Number 1 Region: 729-955
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.19e-27
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.021
Further Details:      
 
Domain Number 2 Region: 30-214
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000159
Family Pyruvate oxidase and decarboxylase Pyr module 0.039
Further Details:      
 
Domain Number 3 Region: 445-630
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000000118
Family Pyruvate oxidase and decarboxylase PP module 0.073
Further Details:      
 
Domain Number 4 Region: 280-408
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000118
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269796.Rru_A2185
Sequence length 1168
Comment (Rhodospirillum rubrum ATCC 11170)
Sequence
MTIQAPINRSELSPQAFAPELEDKYALTGGRAYMTGTQALVRLALAQRRSDRKAGLDTRG
FISGYRGSPLGGFDKELWKARPWLEAEGIVFKPGINEDLAATAVWGSQQVGLFKGARQQG
VFGIWYGKGPGIDRSGDVFKHANNAGTAPLGGVLLIAGDDHAAKSSTAAHQCEYSFMDAM
IPVLHPAGLEEVISFGLFGLALSRYSGCWVALKTIAETVDSSAPVLLDPDPPAFLLPAEG
QAPVGGLHIRWPDPALDQEARLMRHKLYAALAFARVNRIDKVVMDSPVPRLGIVSVGKAY
LDVRQALDDLGIDPAMAAAIGLRLYKVGMPWPLEREGVRAFAEGLEEILVVEEKRAVVEN
QIKEQLYNWREDVRPRVVGKFDESGAWLLPSAGELTPAMVARALAGRIGRFVTGPSIRDR
LDWLERKDAALAGPTAVLKRLPTYCAGCPHNTSTTLPEGSRALAGIGCHYMVTWMPERAT
ATFSQMGGEGVAWIGQAPFTDEPHVFVNLGDGTYFHSGILAIRAAVAAGVNVTYKILVND
AVAMTGGQPIDGLLSVDGLSRQLEGEGVGKIVVVSDEPGKYPIGTVFAAGVTIRHRDDLD
AIQKDLRGWPGVSAILYDQTCAAEKRRRRKRGLLADPDRRVFINDLVCEGCGDCGKVSNC
VAIEPLETEFGRKRSVDLSACNKDYSCLKGFCPSFVTVSGAEVRRPEGVGEVAFPPLPEP
RLADLGAPYSILVTGIGGTGVVTIGALLGMAAHLEGKGVTVLDQTGLAQKNGAVTTHVRI
AASQEALHAVRIAAGNANLLLGCDALTAAGPEVLAKARPRATDAVINTRPVMTAAFTRDP
DSRYPEAEVRAALSATTRRAFFLDATTIATALMGDSLATNPFMIGYAWQKGLLPLGRAAI
ERAITLNGAAVAFNLEALLWGRRAAHDLEAVTALLDRAGGGPEHHRRSESVAETIERRAT
FLAAYQNAALAARYRRLVEAVVAVEKRVRPGGEALSEAVAKAYFKLLAYKDEYEVARLYS
DGRFAQALAARFSGKPRLTVHLAPPLMSPRDPTTGRLRKRAFGAWIFPLFRLLARLKGLR
GTPFDPFGQTSERRLQRRLITEYETTLGVILERVDPQGYDLAVEIAGLPLEMRGFGPVLV
EAVTKAQARERTLLAAFLAPRPLASAAE
Download sequence
Identical sequences Q2RSB0
gi|386350264|ref|YP_006048512.1| WP_011390034.1.3410 YP_427272.1.57063 269796.Rru_A2185 gi|83593520|ref|YP_427272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]