SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269796.Rru_A2398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269796.Rru_A2398
Domain Number 1 Region: 802-1175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.58e-119
Family PFOR PP module 0.000000073
Further Details:      
 
Domain Number 2 Region: 422-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.81e-78
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000714
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-73
Family PFOR Pyr module 0.0000000472
Further Details:      
 
Domain Number 4 Region: 255-417
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.83e-44
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000933
Further Details:      
 
Domain Number 5 Region: 667-839
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.7e-19
Family Ferredoxin domains from multidomain proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269796.Rru_A2398
Sequence length 1186
Comment (Rhodospirillum rubrum ATCC 11170)
Sequence
MVAIDGNEACASVAYRVSEVAVIYPITPSSTMGELSDEWSAKGLTNIWGAVPQVVEMQSE
GGAAGACHGAIQTGSLGTTFTASQGLLLMIPNMYKIAGELTPFCMHVTARTLATHALSIF
GDQSDVMACRQTGFAILASASVQEAHDLASVAHGASLESRIPFLHFFDGFRTSHEVNKIE
LMTDDDLHAMIDDDLVAAHRARALTPDTPVTRGTAQNPDTFFQAQEARNPFYDACPAIVQ
SYMDRLAALTGRRYGLFDYVGHPQAERVVVIMGSGAETVAETVDWLVARGEKIGVVKVRL
FRPFSVDAFVAALPVSVRAIAVLDRCKESGAIGEPLYLDVVGALARAKALGLRAGIVDPA
VIGGRYGLSSKEFTPAMVKAIFDELAKANPKQAFTVGIEDDVTHLSLSVDRSFRIESADI
KRSVFFGLGADGTVGANKNSIKIISDSPTIHGQGYFVYDSKKSGAITISHLRFGPRPIRA
PYLIDEADFIACHHFSFLDKVDVLETAAVGATLLLNSPHDKDTVWDALPRPVQQTIIDRD
LKLFVIDANKVAQETGMGQRINTIMQTCFFALSGVMPRDEAIEEIKKAISKTYARKSQKV
IDANFAAVDQTLSRLQSVTIPGVLTGHALPPLVSAGAPDFVRNVTAVMLAGKGDSLPVSA
MPVDGTWPTETARWEKRDIAQQVCSWDADLCIQCNKCVMVCPHAALRVKAVPAEAAAALP
ASMNSTPYKGKDDLKGSAYVLALSPEDCTGCGICVEACPGKDKATGARSLTMHAREDVVS
ACKENWEIFLDLPDVARTSLRPTVKNSQFMTPLFEFSGACQGCGETPYLKLLTQMWGDRL
MIANATGCSSIYGGNLPTSPYAKDANGRGPAWSNSLFEDNAEFGLGFRLALDQHRSEAKR
LLGALAPQLSGVLVDGLVANAANNDEAAIAAQRERVVSLRAELGGLTGWQARALEGLADY
LVEKVVWIVGGDGWAYDIGYGGLDHVISSGRNVNILVMDTEVYSNTGGQQSKSTPIGASA
KFSVAGKALPKKDLGQIAMANGHVYVASIAFGASDNQTLRALSEAVSYEGPSLIIAYSHC
IAHGYDLTCGLSQQKLAIETGYWPLYRFDPRKMGVGPALSLDGVQPSRPIGDYMANEGRF
RIIRDADPERYAMLLEAAEENVRSRWALLRQLAGVADEQEGARAAQ
Download sequence
Identical sequences gi|83593733|ref|YP_427485.1| WP_011390151.1.3410 YP_427485.1.57063 269796.Rru_A2398 gi|386350478|ref|YP_006048726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]