SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269796.Rru_A2721 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269796.Rru_A2721
Domain Number 1 Region: 205-461
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.44e-57
Family Pyruvate oxidase and decarboxylase Pyr module 0.073
Further Details:      
 
Domain Number 2 Region: 12-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.27e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 476-578
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.63e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269796.Rru_A2721
Sequence length 595
Comment (Rhodospirillum rubrum ATCC 11170)
Sequence
MMTVSRKAVSSVSIALTGSGGAGVMTAGQILLDAAARAGFYGLMAKSLGPQIRGGESAAL
LRLSTRPVETPDDVYDILLAVDWGNVERFSAELPLAPTSVILADPAQGVVPPVMRAADPI
VVDVALKELAAGVPGGRVNMVALGLLAALIGLPQDSLAQVLAETLEKKGPAALDSSLAAL
RAGAAAAEAIPGCVCLPAPPSAPARWLISGNEASAFGALKGGIRFVAAYPITPATEILEW
LAPELPKVGGCLVQAEDELASINMILGGSFGGVPALTATSGPGLALMTESLGLGVASETP
IVVCNVMRGGPSTGIPTKSEQVDLNIALYGLHGDAPHVVTAPNGIGDCAATTQWSVHLAE
AMQVPVIVLSDQAMGQSRAIIDKPATRASVAQRLTAPPRAKSDETPYARYGVTASGISPM
AVPGTPGCAYTADGLEHSPRGMPSTQASHHGEQLDKRLRKLTGFAYGDAWADIEGDGPTA
LITWGSVTAAAREAAARLAEDGIAVRLISLRLIAPALPEAFAQALAGVSRALIVEQNHGR
QFYRYLRSVYDLPADTITYNRPGPVVLRPHEIVSAVKSWGARVHPPASEQTGQGE
Download sequence
Identical sequences Q2RQS7
WP_011390531.1.3410 YP_427805.1.57063 gi|386350806|ref|YP_006049054.1| gi|83594053|ref|YP_427805.1| 269796.Rru_A2721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]