SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A2175
Domain Number 1 Region: 32-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.68e-52
Family PFOR PP module 0.072
Further Details:      
 
Domain Number 2 Region: 302-477
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.55e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2175
Sequence length 481
Comment (Methanosarcina barkeri fusaro)
Sequence
MAAEIINGEKVIGRPKALYADYPRKGPVASTATHYCPGCGHGVLHKLIAEAIDDLGIQDR
TVMISPVGCAVFAYYYFDTGNIQVAHGRAPAVGTGVSRAEENAVVISYQGDGDLASIGLN
ETLQAANRGEKLAVFFVNNTVYGMTGGQMAPTTLVGEKTTTCPEGRDPRFAGYPLHICEL
LNNLKAPVFIERVSISDISHIRKARKAVHKALEIQRDGKGYAFVEVLAACPTNLKMNAEQ
AINFINEEMEKEFPVKNFRDNSKEVEPLHRGVSDFTTKAIEQLYGIEAEAEEKPARKDFA
PIQTKIAGFGGQGVLSMGLILAQAGVKANLNASWFPSYGPEQRGGTSNCSVVISGQPIGS
PTVYTPDILIAMNRPSLEKFEGVVREGGLILYDSSIGEAETPANIKAVAVPATEKAKEAG
SEKAANSFMLGVLMGLDATSLKEEVFKEALAENFAGKTKVIEFNQMVLEAGAQWARENVN
F
Download sequence
Identical sequences A0A0E3QN56 Q46AI9
WP_011307149.1.36239 WP_011307149.1.74748 gi|73669668|ref|YP_305683.1| 269797.Mbar_A2175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]