SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A2214
Domain Number 1 Region: 193-448
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.9e-63
Family Pyruvate oxidase and decarboxylase Pyr module 0.064
Further Details:      
 
Domain Number 2 Region: 3-217
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.75e-41
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0029
Further Details:      
 
Domain Number 3 Region: 465-572
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000414
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2214
Sequence length 574
Comment (Methanosarcina barkeri fusaro)
Sequence
MEYTLRVGGEAGQGLQTIGGALAQVFSKIGFHVFTHQDYMSRVRGGHNFYQIRFSEKEIS
ASRDMVDILLALDLDTIEIHRKSVRDEGFILYDSEITKKKFEEPEFIDIPFKKIALDVGK
KSVMANTVATGAALGILDLGLETFRNVLKKAFEKKGDEVIQGNIACAEAGYNYARKNCPR
CEAPEIREPENRGLMLIDGVNAIGMGALMSGCKFYSGYPMTPSTGILNYMASRAEEYNLV
VEQVEDEISAINMAIGASFAGVRAMTGTSGGGFALMVEGLSLAGMTETPIVIAEMQRPGP
ATGLPTRTEQADLLFVLYAAHGEFPRVIFEPGDPKQAFYLTNKAFELAEKYQIPVFIQSD
QYLGDTEWTYEKFDLENIIYNDYRLREKDLEGVEVYKRFKYSSTGISLLAVPGEAGKHLV
VVDSDEHDEEGHIIEDSETRIKMVQKRMLKKLPLIKKEIDPPLLYGDSSPKIVLVGRGST
YGVIKEVVDTISKDHKVAMMHFSQVYPLPERDKFDYIELLENADLTICIENTATGQFAKL
MRAETGFEFTHQILRYDGRPFTIENLKEELHAYI
Download sequence
Identical sequences A0A0E3QNW0 Q46AF2
WP_011307186.1.36239 WP_011307186.1.74748 269797.Mbar_A2214 gi|73669705|ref|YP_305720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]