SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A2850 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A2850
Domain Number 1 Region: 148-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.26e-112
Family Enolase 0.000000236
Further Details:      
 
Domain Number 2 Region: 14-146
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.22e-59
Family Enolase N-terminal domain-like 0.00000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A2850
Sequence length 428
Comment (Methanosarcina barkeri fusaro)
Sequence
MSYIGLQQDSGEYKIQKIHAREILDSRGNPTVEVDVFTPKGFGRAGVPSGASTGTNEALE
LRDADPNRYGGKGVLTAVKNVNTIIQKELLGLDVRNQREIDELMIELDETDNKSNLGANA
ILGVSMAVARAAADSLNVPLYRYLGGSNAFTLPVPTMNVLNGGKHAGNDLAIQEFMIQPK
GAETFYEALQIGAEIYHVLGKILEKKYGRSSTNVGYEGGYAPKMSESTEALDALAQAIEE
AGYTDTEVTIGLDAAASEFYEDEAYAIDGKKLSAPELMDYYVELVNSYPILSIEDPFYEE
AFEDFEALTNELWDTIIVGDDLFVTNIERLSKGVDMGAANALLLKVNQIGTISEAFDAAN
MASRNGYTVIVSHRSAETEDTTIADISVAIGAEMIKTGAPARGERTAKYNQLLRIEEDLG
EVAHYVQL
Download sequence
Identical sequences A0A0E3QME3 Q468E2
gi|73670315|ref|YP_306330.1| WP_011307791.1.36239 WP_011307791.1.74748 269797.Mbar_A2850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]