SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269797.Mbar_A3474 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269797.Mbar_A3474
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.42e-27
Family Crotonase-like 0.046
Further Details:      
 
Domain Number 2 Region: 377-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000248
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269797.Mbar_A3474
Sequence length 442
Comment (Methanosarcina barkeri fusaro)
Sequence
MSKKRPITMSVKRGPHLFFILFLCFVLIAVSMPSGDAGPQQKVLVLEVSEAITPASDDII
ADAIEKAENENFEALVISLNTPGGGLDETQTIISAIENASVPVIGYVPESGKAWSAGTLI
LMGTDIAAMAPFTVIGSAQPVQVSIEGTKPITDEKIINALVKFSVATAGKHGRNETFAEE
VITKNKNLDAQEALQTGVIEYVAPSIPNLLTQIDGQEIKGKVLQTENAGIENYEPPFSLS
LLGLISNPIISSLLLTLGIYGLIFGISSPGAGAEIFGLISIALGLMGTGFDINIGAIFLI
LLGIGLLIIEIKVPGFGIFGVAGLISLVIGSILLVPMGSENIYTPEFRKVLALTVVAPTV
VFGLFLVFAIYKVTESRKKKPVIGEFIGETAETIDPLGPQKTGFVRYKGEYWKARSEEEI
EPNVEVEITGKVRETLLVKRKM
Download sequence
Identical sequences A0A0E3QKZ8 Q465U5
gi|73670912|ref|YP_306927.1| 269797.Mbar_A3474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]