SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_2257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_2257
Domain Number 1 Region: 14-144
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.2e-17
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_2257
Sequence length 190
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MKQELALFIKKIIDLPAAEEKKLLAITRVYKVPKGDFYIQIGQIPKKFAFVAKGLFRYVY
IDSKGNEFTKNFVPENNFALAYSSMIRHEVSKMAIEALEDSIICEIDYTDWLTLKKGNAC
WNIFLITILENAFTIKENRERDLLLLDAEQRYETFRQEFPALETRVKQHLIASYLGISPV
SLSRIRKKRT
Download sequence
Identical sequences Q11SU4
gi|110638653|ref|YP_678862.1| 269798.CHU_2257 WP_011585637.1.19587 WP_011585637.1.79486 371552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]