SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_2415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_2415
Domain Number 1 Region: 128-349
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.17e-49
Family D-glucarate dehydratase-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.89e-16
Family Enolase N-terminal domain-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_2415
Sequence length 360
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MEIRWKKHRLDFTFQAGTSRGVLTHKDTWYLIGEESGKEFYGECGPLKGLSIDDRPDFES
RLNVVCAHLNTRSVHAWNTLGFVDSLIPELDLIGFPSIVMALETLQADYLNAYKREIFES
SFYTFGSPIAINGLVWMNEPEDMYAQAIKKIEAGFSCVKFKVGAIDFEKECRIFEKIREQ
YPEEQVNIRVDANGAFTEQDVWQKLEKLATYGIHSIEQPIKPKQEELMRQLCKDAALEIA
LDEELIGMSALQEKERLLEELNPPFIILKPTLLGGFAATEEWIRAAEFRGIEWWMTSALE
SNIGLNAICQFTSTFPVYMPQGLGTGSLYHNNIPSPLTVENGHIFYDTTKPWDFSALKNR
Download sequence
Identical sequences Q11SE3
gi|110638804|ref|YP_679013.1| 269798.CHU_2415 WP_011585785.1.19587 WP_011585785.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]