SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269798.CHU_2844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269798.CHU_2844
Domain Number 1 Region: 3-148
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.33e-16
Family Crotonase-like 0.018
Further Details:      
 
Domain Number 2 Region: 344-405
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000615
Family NfeD domain-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269798.CHU_2844
Sequence length 407
Comment (Cytophaga hutchinsonii ATCC 33406)
Sequence
MSHFVELGLQAATRDSADYIILDMDTYGGALLDADKIRMALLKYPKPVYVYINKNAASAG
ALISIACDSIYMDAGSIIGAATVVDGEGKPAPDKYQSDMRAMMRTTAETNHRNPVFAENM
VGKAVGADSLTVGNVTTFTTSEAIKNGYCEAEIHSLEELYTYLHLHHAAITHFELSTTDQ
IVNFFMNPALRGLLLLLIIGGIYFELQTPGIGVALFAALVGIALYFIPSYLNGLAENWEI
LIFFIGAVLLILEITVIPGFGLAGLSGLVLIVSSLILVGLNNDTFDFTFVPESDIYITSA
TVLAAFTAGTVLAFAAGNRFMKSALFNKISLQDTFQSSDGFTSNFHTEVLTGKQGTSYSV
LRPSGKILLDGNVYDAYTRGEYVEANKAVEVIEQVGSSLKVKEIHVQ
Download sequence
Identical sequences Q11R72
WP_011586202.1.79486 gi|110639225|ref|YP_679434.1| 269798.CHU_2844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]