SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_0063 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_0063
Domain Number 1 Region: 106-251
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.13e-37
Family Potassium channel NAD-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 7-125
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-23
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 3 Region: 236-329
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 1.44e-16
Family TrkA C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_0063
Sequence length 351
Comment (Geobacter metallireducens GS-15)
Sequence
MDPVRHFKISIAVLLLLVSVGTAGYMAIEGWQFLDALYMTVITLGTVGFKEVHDLSNAGK
IFTIGLIIFGVSVLGYIVGSLAQIMFEGQIQRIIGRKKVERKIEALHDHYIICGFGRIGA
LICREFAAKPMPFLVIEKHPEVHEKLHHEEYLHIRGDATEDETLLRAGIKRAKGLISVVT
SDTENVYITLTARGLNPDLFILARSGEEGSELKLKRAGANKVVSPYVIGGSRMAQAILRP
NVVDFIEIATGREHLDLQMEEIQIPEKSAFIGENLVTSGFRKETGVIIVGIKKASGKMVF
NPNPHTKIEALDTLIVLGEPVAITKLEQLVACESCADTIIKKHRKEHPDHV
Download sequence
Identical sequences Q39ZL2
269799.Gmet_0063 gi|404494917|ref|YP_006719023.1| WP_004514187.1.25803 WP_004514187.1.48315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]