SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_0813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_0813
Domain Number 1 Region: 9-187
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.19e-26
Family Crotonase-like 0.085
Further Details:      
 
Domain Number 2 Region: 359-425
Classification Level Classification E-value
Superfamily NfeD domain-like 7.85e-21
Family NfeD domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_0813
Sequence length 446
Comment (Geobacter metallireducens GS-15)
Sequence
MHRIITLCILLCCLLPAVALPADSATVRVLGVRSAINPVTASFLKRNLVDAARRGDRLVL
IDMDTPGGLDTAMREIVKDILASPVPVAVHVAPSGARAASAGAIICLAADICAMAPGTTI
GAAHPVSIGEKQDKVMEEKVVNDAEAYAEGLANRRGRNAAVARRMVRESLSLSAEKALAE
KVVDLIAADRASLLAQLEGRRVARPGGDVVLGLAGAVVREEPMTARERILDVIGNPNVAY
ILMMLGFLGIFFELSNPGVILPGVIGGISLILAFFAFQTLPVNYAGVLLILLALILFIAE
IKIVSHGMLTVGGVIAMVLGSLLLFESPEPYLRVSWQVIAITVIAISAFSVFAVTMAVRV
HRRKPTTGGEGLLGESGKALSAISPEGRVFIHGEYWDAWSDEPLAEGDRVTVVAVEGMRV
KVRKTGDRGPGKAFRQGLPCDAVIIA
Download sequence
Identical sequences Q39XG9
269799.Gmet_0813 WP_004514400.1.25803 WP_004514400.1.48315 gi|404495672|ref|YP_006719778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]