SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_1172 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  269799.Gmet_1172
Domain Number - Region: 69-113
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0118
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_1172
Sequence length 145
Comment (Geobacter metallireducens GS-15)
Sequence
MKKTVLVALAVASLAAAGCKEKPKAPETTAPQQSGMPAQPGQGQMPSDAVHGGANPHAGL
KAVEVPAGAGHKGKVVSTMDAAGYTYLEVEEKGQKLWVAVMQTKVKVGDEVEFPDSPPMV
NFHSKTLNRTFEKIIFAPGVRIAGK
Download sequence
Identical sequences Q39WG4
gi|404496032|ref|YP_006720138.1| 269799.Gmet_1172 WP_004513438.1.25803 WP_004513438.1.48315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]