SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269799.Gmet_1826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269799.Gmet_1826
Domain Number 1 Region: 6-191
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.01e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269799.Gmet_1826
Sequence length 192
Comment (Geobacter metallireducens GS-15)
Sequence
MSDTITNILLVGVGGQGILLASEVLSETFMQAGYDVKKSEIHGMSQRGGSVVSHVRYGRE
VHSPIIPEGEGDILFGFEILETYRSLPLMKNGGTVIANDLRIPPPSVLLGQETYPDDLPG
KIAAMFPDSLLVDGQKLAAEAGNVRAANTVLLGAVSKRLDIPDECWIKALEKMIPPKALK
VNHVAFQLGRSL
Download sequence
Identical sequences Q39UL9
gi|404496683|ref|YP_006720789.1| WP_004512019.1.25803 WP_004512019.1.48315 269799.Gmet_1826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]