SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_0383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_0383
Domain Number 1 Region: 16-227
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-36
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_0383
Sequence length 312
Comment (Thermobifida fusca YX)
Sequence
MANWAWRDTLARFVDSQWFQNLVVAVILANGVVLGLETYEDRFVWLDRNWMLIEGCFLTF
FVLELTLRILARGVVFFRDVWNWFDLVVVGISLIPLAGGFAVLRLVRVLRLLRLVSVLPS
LRYIVDALFRSVPGLGTVIALLFVVMYTAAIMGEQLFGEISPQYFGNLGTTLYTLFMLLT
MENWPDISDSVIEDAPYAWIFFVSYIVVSAFIVLNLIIGVIVTTMEEEVSAPRWAEDQEI
ELHQHEQVMLRLEQLSDQVAVLSAQLRALGVAVEEVSNFRVLPLESTRHEKRPSAKRGRR
TRRKNRRRRRSA
Download sequence
Identical sequences Q47SZ6
gi|72160787|ref|YP_288444.1| 269800.Tfu_0383 WP_011290830.1.46431 WP_011290830.1.72373 WP_011290830.1.82272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]