SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_0428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_0428
Domain Number 1 Region: 137-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.06e-131
Family Enolase 0.0000000327
Further Details:      
 
Domain Number 2 Region: 4-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.19e-52
Family Enolase N-terminal domain-like 0.00000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_0428
Sequence length 427
Comment (Thermobifida fusca YX)
Sequence
MASIEAVHAREILDSRGNPTVEVEVALDDGTIARAAVPSGASTGQFEAVELRDGGDRYGG
KGVEKAVAAVNEEISEQIVGYEAEEQRLVDSALITLDGTPDKSRLGANAILGVSLAVAKA
AAESADLPLFRYLGGPNAHVLPVPMMNILNGGAHADTNVDIQEFMIAPIGAESFREALRW
GAEVYHSLKAVLKAHGLATGVGDEGGFAPNLDSNRAALDLISEAITKAGFTLGQDIALAL
DVAATEFYADGAYQFEGSSRSAEEMAAYYTELVESYPLVSIEDPLSEEDWAGWKALTESL
GDRLQLVGDDLFVTNPERLQRGIDEGAANSLLVKVNQIGTLSETLDAVSLAQRNRYTAMI
SHRSGETEDTTIADIAVATNSGQIKTGAPARSERVAKYNQLLRIEEELDDAAVYAGANAF
PRFARQG
Download sequence
Identical sequences Q47SV1
269800.Tfu_0428 WP_011290875.1.46431 WP_011290875.1.72373 WP_011290875.1.82272 gi|72160832|ref|YP_288489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]