SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_1717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_1717
Domain Number 1 Region: 110-355
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.03e-67
Family D-glucarate dehydratase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.24e-25
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_1717
Sequence length 359
Comment (Thermobifida fusca YX)
Sequence
MRITEITAEAYRLPLHRAWDGGVDRNDVVVVRVATDTGQTGTGFAWTPLIGAGAVLALLR
NDCPAVLLGRDANPYARWEELRWHLREAGTSGLTLMAIAAVDIALWDLTARAAGASLVDL
IGRRRDRVAAYGSGVNLDYSLDELLEQVRGWLAAGHRAVKIKVGSPELERDVERVAAVRE
LIGPDRLLMIDANQRWDLPTAIRALAAMERFDPYFVEEPLPADDLAAHARLRAHTRIPLA
IGENLRTIAEFETALQLGVCDIAQPNAVRVGGITPFLRIAELAARHSVPVAPHLLPELST
QLALCLPRVAMVEDIDRASFAALGALARPSGVEISAGWATAQTGPGHGLEFAADLAPIG
Download sequence
Identical sequences Q47P67
269800.Tfu_1717 WP_011292143.1.46431 WP_011292143.1.72373 WP_011292143.1.82272 gi|72162118|ref|YP_289775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]