SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 269800.Tfu_2226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  269800.Tfu_2226
Domain Number 1 Region: 79-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000101
Family NfeD domain-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 269800.Tfu_2226
Sequence length 146
Comment (Thermobifida fusca YX)
Sequence
MSVWVVWLVLAVALGVAELFTLTLALGLIGAAALIAGVVGAFGVGLTGQVLVFAVASAAG
LLVVRPIARRHMTQPPPLRSGTEALVGRSALVVEEITATGGRIKLQGEEWSARCLDETLR
IPVGAHVDVMEIEGATAVVYPRDELP
Download sequence
Identical sequences Q47MR1
gi|72162625|ref|YP_290282.1| WP_011292649.1.46431 WP_011292649.1.72373 WP_011292649.1.82272 269800.Tfu_2226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]