SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_I0188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_I0188
Domain Number 1 Region: 20-145
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.87e-26
Family D-glucarate dehydratase-like 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_I0188
Sequence length 156
Comment (Burkholderia thailandensis E264)
Sequence
MSNMTSNAIEAAAQAHANTHTPSPSVAQRCDEWGRTWGSHSNHHFDISLAMFTHVAAAAP
GNITAIDAHWIWQEADERLTREPLAIARGHVAVPEGPGLGIALDMDRVMQAHALYETLGP
GARDDARAMQYRVPGWAYHPKRPSFGSAARAAARGA
Download sequence
Identical sequences A0A2C5UVS1 Q2T253
WP_009908327.1.21694 WP_009908327.1.22957 WP_009908327.1.28510 WP_009908327.1.28912 WP_009908327.1.31764 WP_009908327.1.44093 WP_009908327.1.49905 WP_009908327.1.66095 WP_009908327.1.68421 WP_009908327.1.6992 WP_009908327.1.7190 WP_009908327.1.83779 WP_009908327.1.8909 gi|83720349|ref|YP_440746.1| 271848.BTH_I0188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]