SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 271848.BTH_I0328 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  271848.BTH_I0328
Domain Number 1 Region: 731-976
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.06e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Further Details:      
 
Domain Number 2 Region: 27-213
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.48e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.096
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000402
Family Pyruvate oxidase and decarboxylase PP module 0.035
Further Details:      
 
Weak hits

Sequence:  271848.BTH_I0328
Domain Number - Region: 276-400
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0011
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 271848.BTH_I0328
Sequence length 1191
Comment (Burkholderia thailandensis E264)
Sequence
MNARLPIDGPPALADYRLTDNLSATRGRIFLTGTQALVRLLLMQRALDAAQGVNTAGFVS
GYRGSPLGMVDQQLWKAKKQLDASGVRFLPAINEELGGTAVLGTQRVEADPERTVDGVFA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPI
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALTVRWPAPEGFAPP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARANSIDKWIARSARANIGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSFPLEMTRIDAFVDGLSEVLVIEEKGPVIEQQIK
DHLYNRPPDARPVVLGKHDAAGAPLLSELGELRPSRILPVFAEWLARHKSALDRRERVVD
LVAPSILSNEADVVRRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMDRDTTGLIQ
MGGEGVDWAAHAMFTNTRHVFQNLGDGTYFHSGILAIRQAVAARANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHDLFPKGTTFHHRRELDAVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINEAVCEGCGDCGVQSNCLSVE
PVETTLGRKRRIDQSSCNKDFSCVNGFCPSFVTVEGAKLKKAAGVAFDEAALAARVEALP
RPATHLADAPYDMLVTGVGGTGVVTVGALVSMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIASSDAWLNQVRIDTQQADVLLACDMVVGASADALQTVRRERTRIVVNTHAIPNAAFVR
DPDASLHADALVEKMRHAAGDGFLSRCDAQALATKFLGDTIGANILMLGFAWQQGLVPVS
LDAMMRAIELNNVAVPMNRLAFSIGRLAAADAAGLDALWDARHPAHAPLPPQTLDAIVAD
REARLAEYGGARYAERYRALVGAARATGAERVARAVATTFYRLLAVKDEYEVARLYTDGA
FRAALEAQFEGAAGRDFRVKFNLAPPATAKAGSNGAAPRKQVFGQWLWPVLGVLARVRGL
RGTRLDPFGRTVERRMERALADDYETTMRRAFAVLTPQTADLVARLAELHAKARGYGHVK
LANVAGVKRSERELAARLSIDAATSAAVQRALDEMKGAGALRGIPIVVAKS
Download sequence
Identical sequences A0A2C5VR46 Q2T1R3
WP_009893298.1.101337 WP_009893298.1.21694 WP_009893298.1.22957 WP_009893298.1.28510 WP_009893298.1.28912 WP_009893298.1.44093 WP_009893298.1.49905 WP_009893298.1.66095 WP_009893298.1.68421 WP_009893298.1.6992 WP_009893298.1.7190 WP_009893298.1.83779 WP_009893298.1.8909 gi|83719837|ref|YP_440886.1| 271848.BTH_I0328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]